DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and Prss27

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_891994.3 Gene:Prss27 / 287108 RGDID:1303256 Length:328 Species:Rattus norvegicus


Alignment Length:278 Identity:90/278 - (32%)
Similarity:130/278 - (46%) Gaps:45/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLSILV------SIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRA 63
            |||.:|:      :.|..||..  |....|:|||........|||||:|.|..|.|||.:.:...
  Rat    10 LLLPLLLRSGTEGAEAMRACGH--PRMFNRMVGGEDALEGEWPWQVSIQRNGAHFCGGSLIAPTW 72

  Fly    64 ILTAAHCLSNVTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKYVP----KLYNPY-------DIA 117
            :||||||.||  .:|:|:     |....| .||:.:...|..|||    |.:..|       |:|
  Rat    73 VLTAAHCFSN--TSDISI-----YQVLLG-ALKLQQPGPHALYVPVKRVKSHPEYQGMASSADVA 129

  Fly   118 VLILEAPLRLGGTVKKIPLAEQTPV--AGTIVLTSGWGYTRENSSFLWP-ILQGVHVAILNRTDC 179
            ::.|:.|:.....:..:.|.:.:.|  :|.....:|||...|......| |||.:.|.:::...|
  Rat   130 LVELQVPVTFTKYILPVCLPDPSVVFKSGMNCWVTGWGSPSEQDRLPNPRILQKLAVPLIDTPKC 194

  Fly   180 LKAYKH--------VNITIDMIC---ADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCG 233
            ...|..        ..|..||:|   |:|:: |.|:|||||||:........| .|::|||:||.
  Rat   195 NLLYSKDAEADIQLKTIKDDMLCAGFAEGKK-DACKGDSGGPLVCLVDQSWVQ-AGVISWGEGCA 257

  Fly   234 --TNPGVYEDIAFFHNWI 249
              ..||||..:|..:.||
  Rat   258 RRNRPGVYIRVASHYQWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 80/247 (32%)
Tryp_SPc 29..250 CDD:238113 81/248 (33%)
Prss27NP_891994.3 Tryp_SPc 37..275 CDD:214473 80/247 (32%)
Tryp_SPc 39..278 CDD:238113 81/247 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.