DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and Prss3b

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_775150.1 Gene:Prss3b / 286911 RGDID:708437 Length:247 Species:Rattus norvegicus


Alignment Length:256 Identity:84/256 - (32%)
Similarity:128/256 - (50%) Gaps:21/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCLSN 73
            |.::..|.|.|..:...:::||||.......:|:|||: |...|.|||.:.:.:.:::||||.. 
  Rat     5 IFLAFLGAAVALPLDDDDDKIVGGYTCQKNSLPYQVSL-NAGYHFCGGSLINSQWVVSAAHCYK- 67

  Fly    74 VTVTDLSVRAGS---SYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGTVKKIP 135
               :.:.||.|.   .....|.|.:...|.|.||.|....:: .||.::.|.:|..|...|..:.
  Rat    68 ---SRIQVRLGEHNIDVVEGGEQFIDAAKIIRHPSYNANTFD-NDIMLIKLNSPATLNSRVSTVS 128

  Fly   136 LAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHVNITIDMIC---ADG 197
            |......:||..|.||||.|..:.:....:||.:...:|:.:.|..:|.. .||.:|.|   .:|
  Rat   129 LPRSCGSSGTKCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCKSSYPG-KITSNMFCLGFLEG 192

  Fly   198 QRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGT--NPGVYEDIAFFHNWIKYTVKKN 256
            .: |:||||||||::     .:.||.|:||||.||..  .||||..:..:.|||:.||..|
  Rat   193 GK-DSCQGDSGGPVV-----CNGQLQGVVSWGYGCAQKGKPGVYTKVCNYVNWIQQTVAAN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 75/228 (33%)
Tryp_SPc 29..250 CDD:238113 76/228 (33%)
Prss3bNP_775150.1 Tryp_SPc 24..240 CDD:214473 75/228 (33%)
Tryp_SPc 25..243 CDD:238113 77/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.