DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and Tpsg1

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:256 Identity:87/256 - (33%)
Similarity:127/256 - (49%) Gaps:24/256 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AGLACA-ARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCLS-NVTV 76
            :|..|. .::.....|||||...|....|||.|::.:.:|.|||.:.|...:||||||.| :|..
Mouse    71 SGSGCGHPQVSNSGSRIVGGHAAPAGTWPWQASLRLHKVHVCGGSLLSPEWVLTAAHCFSGSVNS 135

  Fly    77 TDLSVRAG------SSYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGTVKKIP 135
            :|..|..|      |.::|...:::....:...|.      :..|||::.|.:|:.|...|:.:.
Mouse   136 SDYQVHLGELTVTLSPHFSTVKRIIMYTGSPGPPG------SSGDIALVQLSSPVALSSQVQPVC 194

  Fly   136 LAEQTP--VAGTIVLTSGWGYTRENSSFLWPI-LQGVHVAILNRTDCLKAYKHVN---ITIDMIC 194
            |.|.:.  ..|.....:|||||.|......|. ||...|::::...|.:||...|   |..||:|
Mouse   195 LPEASADFYPGMQCWVTGWGYTGEGEPLKPPYNLQEAKVSVVDVKTCSQAYNSPNGSLIQPDMLC 259

  Fly   195 ADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCG--TNPGVYEDIAFFHNWIKYTV 253
            |.|. .|.||.||||||:....|..:| .|:||||:|||  ..||||..:..:.|||.:.:
Mouse   260 ARGP-GDACQDDSGGPLVCQVAGTWQQ-AGVVSWGEGCGRPDRPGVYARVTAYVNWIHHHI 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 83/235 (35%)
Tryp_SPc 29..250 CDD:238113 83/235 (35%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 84/237 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.