DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and Try4

DIOPT Version :10

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_035776.1 Gene:Try4 / 22074 MGIID:102757 Length:246 Species:Mus musculus


Alignment Length:232 Identity:51/232 - (21%)
Similarity:73/232 - (31%) Gaps:97/232 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   648 SQVLLRSLAKK------PGLKDTNFQVLKARLDTARTIVERYGITTTTADYLLTDATEKLG---D 703
            |:.|.|.|.::      ||.:|....|..|               ||.:|...::.||||.   |
Mouse     3 SEELARKLQRRLDADTNPGTQDEETPVKPA---------------TTMSDDTTSELTEKLNRRLD 52

  Fly   704 AKNGSSAAALLTAIAEGGARLDYTVQRAMEFAFEQQKSP--------------------KVQQEV 748
            ..:|::....:....      .||  ...||:.:|.|..                    |:..|.
Mouse    53 IHDGTAKPKQMKVFN------PYT--EFKEFSRKQIKDMETMFKRFDSGKDGFIDLMELKLMMEK 109

  Fly   749 LLWVATAL-------------------REF---------GFQVEAKGLLESARKAVQSSNAAVRT 785
            |....|.|                   |||         |...|..||:..||    .|...|.|
Mouse   110 LGAPQTHLGLKNMIKEVDEDYDGKLSYREFLLIFRRAAAGELQEESGLMALAR----LSEIDVST 170

  Fly   786 AGIALLGAMYLFMGQPLTMFFDSEKPALKQQIMAEFE 822
            .|:  |||         ..||:::..||  .:.::||
Mouse   171 EGV--LGA---------RDFFEAKAQAL--SVRSKFE 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473
Try4NP_035776.1 Tryp_SPc 24..242 CDD:238113 45/211 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.