DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and Prss2

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_033456.1 Gene:Prss2 / 22072 MGIID:102759 Length:246 Species:Mus musculus


Alignment Length:263 Identity:90/263 - (34%)
Similarity:133/263 - (50%) Gaps:30/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSILVSIAGLACAARIP-GPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHC 70
            :|.|:.:|.:..|...| ..:::||||.......||:|||: |...|.|||.:.:|:.:::||||
Mouse     1 MSALLILALVGAAVAFPVDDDDKIVGGYTCRESSVPYQVSL-NAGYHFCGGSLINDQWVVSAAHC 64

  Fly    71 LSNVTVTDLSVRAGS---SYWSKGGQVLKVLKTIAHPKYVPKLYNPY----DIAVLILEAPLRLG 128
            ..    ..:.||.|.   :......|.:...|.|.||.     ||.:    ||.::.|.:|:.|.
Mouse    65 YK----YRIQVRLGEHNINVLEGNEQFVDSAKIIRHPN-----YNSWTLDNDIMLIKLASPVTLN 120

  Fly   129 GTVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHVNITIDMI 193
            ..|..:||......|||..|.||||.|..|......:||.|...:|.:.||..:|.. :||.:||
Mouse   121 ARVASVPLPSSCAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLPQADCEASYPG-DITNNMI 184

  Fly   194 CA---DGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCG--TNPGVYEDIAFFHNWIKYTV 253
            |.   :|.: |:||||||||::     .:.:|.|:||||.||.  ..||||..:..:.:||:.|:
Mouse   185 CVGFLEGGK-DSCQGDSGGPVV-----CNGELQGIVSWGYGCAQPDAPGVYTKVCNYVDWIQNTI 243

  Fly   254 KKN 256
            ..|
Mouse   244 ADN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 81/232 (35%)
Tryp_SPc 29..250 CDD:238113 82/232 (35%)
Prss2NP_033456.1 Tryp_SPc 23..239 CDD:214473 81/232 (35%)
Tryp_SPc 24..242 CDD:238113 83/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.