DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and Prss38

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:268 Identity:75/268 - (27%)
Similarity:128/268 - (47%) Gaps:49/268 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SIAG-LACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCLSN-- 73
            |::| :||..  |..:.:::||.:......|||||:..:..|.|||.|.|...:|:||||...  
Mouse    40 SLSGDVACGQ--PVLQGKLLGGEFARDRKWPWQVSLHYSGFHICGGSILSAYWVLSAAHCFDRGK 102

  Fly    74 --------VTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYNPY--DIAVLILEAPLRLG 128
                    |.:|:|......:.|      .::.:.|.||.:  ::|:|.  |:|::.|::.:...
Mouse   103 KLETYDIYVGITNLEKANRHTQW------FEIYQVIIHPTF--QMYHPIGGDVALVQLKSAIVFS 159

  Fly   129 GTVKKIPLAEQTPVAGTIVL-----TSGWGYTRENSSFLWPILQGVHVAILNRTDC-----LKAY 183
            ..|..|.|    |.:...::     |:|||...........:|: ..:.::.|..|     |.:|
Mouse   160 DFVLPICL----PPSDLYLINLSCWTTGWGMISPQGETGNELLE-AQLPLIPRFQCQLLYGLSSY 219

  Fly   184 KHVNITIDMICADGQRW--DTCQGDSGGPLIETTKGGHRQL-IGMVSWGDGCG--TNPGVYEDIA 243
                :..:|:||...:.  :.|:||||.||:  .|.....| ||:||||.||.  ..|||:.:::
Mouse   220 ----LLPEMLCAADIKTMKNVCEGDSGSPLV--CKQNQTWLQIGIVSWGRGCAQPLYPGVFANVS 278

  Fly   244 FFHNWIKY 251
            :|.:||:|
Mouse   279 YFLSWIRY 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 67/247 (27%)
Tryp_SPc 29..250 CDD:238113 68/247 (28%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 70/248 (28%)
Tryp_SPc 58..284 CDD:214473 67/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.