DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and Prss8

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_620191.1 Gene:Prss8 / 192107 RGDID:619973 Length:342 Species:Rattus norvegicus


Alignment Length:274 Identity:89/274 - (32%)
Similarity:133/274 - (48%) Gaps:32/274 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLSILVSIAG-----LACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAI 64
            ||:.:|.|..|     .:|.|.|   :.||.||........|||||:..|.:|.|||.:.|::.:
  Rat    19 LLIGLLQSRIGADGTEASCGAVI---QPRITGGGSAKPGQWPWQVSITYNGVHVCGGSLVSNQWV 80

  Fly    65 LTAAHCLSNV-TVTDLSVRAGS---SYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPL 125
            ::||||.... :..:..|:.|:   ..:|....|..|.:.|:|..|..: .:..|||::.|.:|:
  Rat    81 VSAAHCFPREHSKEEYEVKLGAHQLDSFSNDIVVHTVAQIISHSSYREE-GSQGDIALIRLSSPV 144

  Fly   126 RLGGTVKKI--PLAEQTPVAGTIVLTSGWGYTRENSSFLWP-ILQGVHVAILNRTDCLKAYKHVN 187
            .....::.|  |.|..:...|.....:|||:...:.|...| .||.:.|.:::|..|...| ::|
  Rat   145 TFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLY-NIN 208

  Fly   188 --------ITIDMICA---DGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCG--TNPGVY 239
                    |..||:||   .|.: |.||||||||| .....|...|.|:|||||.||  ..||||
  Rat   209 AVPEEPHTIQQDMLCAGYVKGGK-DACQGDSGGPL-SCPIDGLWYLAGIVSWGDACGAPNRPGVY 271

  Fly   240 EDIAFFHNWIKYTV 253
            ...:.:.:||.:.|
  Rat   272 TLTSTYASWIHHHV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 78/240 (33%)
Tryp_SPc 29..250 CDD:238113 78/240 (33%)
Prss8NP_620191.1 Tryp_SPc 44..281 CDD:214473 78/240 (33%)
Tryp_SPc 45..284 CDD:238113 79/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.