DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and try-1

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:239 Identity:80/239 - (33%)
Similarity:118/239 - (49%) Gaps:12/239 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EERIVGGSYIPIEYVPWQVSVQNN-SLHCCGGVIYSDRAILTAAHCLS-NVTVTDLSVRAGSSYW 88
            :.|::|||.......||.|.:.:. ..|.|||.:.....:||||||.: :...|..|||.| .:.
 Worm    55 DHRLIGGSESSPHSWPWTVQLLSRLGHHRCGGSLIDPNFVLTAAHCFAKDRRPTSYSVRVG-GHR 118

  Fly    89 SKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGTVKKIPLAEQTPVAGTIVLTSGWG 153
            |..|...:|.....||.|.....:.||.|::.:..|:....|.:.|.|.....|...:.:.:|||
 Worm   119 SGSGSPHRVTAVSIHPWYNIGFPSSYDFAIMRIHPPVNTSTTARPICLPSLPAVENRLCVVTGWG 183

  Fly   154 YTRENSSFLWPILQGVHVAILNRTDCLKAYKHV-NITI-DMICADGQRW---DTCQGDSGGPLIE 213
            .|.|.||...|.|:.:||.:|:...|.....:: .|.: .|:|| |..:   |:|||||||||: 
 Worm   184 STIEGSSLSAPTLREIHVPLLSTLFCSSLPNYIGRIHLPSMLCA-GYSYGKIDSCQGDSGGPLM- 246

  Fly   214 TTKGGHRQLIGMVSWGDGCGT--NPGVYEDIAFFHNWIKYTVKK 255
            ..:.||.:|.|:||||.||..  .||||.::.....||...:.:
 Worm   247 CARDGHWELTGVVSWGIGCARPGMPGVYGNVHSASTWINLEMNR 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 78/229 (34%)
Tryp_SPc 29..250 CDD:238113 78/229 (34%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 78/228 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.