DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and rab-11.1

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_490675.1 Gene:rab-11.1 / 171601 WormBaseID:WBGene00004274 Length:211 Species:Caenorhabditis elegans


Alignment Length:187 Identity:35/187 - (18%)
Similarity:67/187 - (35%) Gaps:65/187 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GVIYSDRAILTAAHCLSNVTVTDLSVRAGSSYWSKGGQ-------------------VLKVLKTI 101
            ||.::.|:|          :|...:|:|  ..|...||                   |..:.|.:
 Worm    45 GVEFATRSI----------SVEGKTVKA--QIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHV 97

  Fly   102 AH---PKYVPKLYNPYDIAVLIL----EAPLRLGGTVKKIPLAEQTPVAG----TIVLTSGWGYT 155
            .:   .:::.:|.:..|..::|:    ::.||   .::.:|..|....|.    :.:.||....|
 Worm    98 TYENVERWLKELRDHADQNIVIMLVGNKSDLR---HLRAVPTDEAKIYAERNQLSFIETSALDST 159

  Fly   156 RENSSFLWPILQGVHVAILNRTDCLKAYKHVNITIDMICADGQRWDTCQGDSGGPLI 212
            ...::|. .||..::.::.|        |||.       .|.|.:    |...|.:|
 Worm   160 NVEAAFT-NILTEIYKSVSN--------KHVG-------TDRQGY----GGGSGTII 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 35/187 (19%)
Tryp_SPc 29..250 CDD:238113 35/187 (19%)
rab-11.1NP_490675.1 PLN03110 5..209 CDD:178657 35/187 (19%)
Rab11_like 9..173 CDD:206660 26/143 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.