DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and KLK11

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_011524671.1 Gene:KLK11 / 11012 HGNCID:6359 Length:307 Species:Homo sapiens


Alignment Length:286 Identity:89/286 - (31%)
Similarity:132/286 - (46%) Gaps:43/286 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LRLLLSILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTA 67
            :|:|..||     ||.|..:.|.|.||:.|........|||.::...:...||..:.:.|.:|||
Human    33 MRILQLIL-----LALATGLVGGETRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTA 92

  Fly    68 AHCL------------------SNVTVTDLS---VRAGSSYWSKG---GQVLKVLKTIAHPKY-- 106
            ||||                  ||..::.||   |..|.....|.   .|.....::..||.:  
Human    93 AHCLKPWVSLTSPTHVSPDLSSSNYCLSHLSRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNN 157

  Fly   107 -VPKLYNPYDIAVLILEAPLRLGGTVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVH 170
             :|...:..||.::.:.:|:.:...|:.:.|:.:...|||..|.||||.|......|...|:..:
Human   158 SLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCAN 222

  Fly   171 VAILNRTDCLKAYKHVNITIDMICADGQRW--DTCQGDSGGPLIETTKGGHRQLIGMVSWG-DGC 232
            :.|:....|..||.. |||..|:||..|..  |:|||||||||:     .::.|.|::||| |.|
Human   223 ITIIEHQKCENAYPG-NITDTMVCASVQEGGKDSCQGDSGGPLV-----CNQSLQGIISWGQDPC 281

  Fly   233 G--TNPGVYEDIAFFHNWIKYTVKKN 256
            .  ..||||..:..:.:||:.|:|.|
Human   282 AITRKPGVYTKVCKYVDWIQETMKNN 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 75/252 (30%)
Tryp_SPc 29..250 CDD:238113 75/252 (30%)
KLK11XP_011524671.1 Tryp_SPc 53..300 CDD:214473 75/252 (30%)
Tryp_SPc 54..303 CDD:238113 76/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.