DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and Try5

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_008761147.1 Gene:Try5 / 103690254 RGDID:1560283 Length:246 Species:Rattus norvegicus


Alignment Length:258 Identity:88/258 - (34%)
Similarity:133/258 - (51%) Gaps:26/258 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVSIAGLACAARIP-GPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCL-S 72
            |:.:|.:..|...| ..:::||||.......||:|||: |:..|.|||.:.:|:.:::||||. |
  Rat     4 LLFLAHVGAAVAFPIDDDDKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINDQWVVSAAHCYKS 67

  Fly    73 NVTVT----DLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGTVKK 133
            .:.|.    :::|..|:.      |.:...|.|.||.:..:..| .||.::.|..|:.|...|..
  Rat    68 RIQVRLGEHNINVLEGNE------QFVNAAKIIKHPNFNARNLN-NDIMLIKLSVPVTLNSRVAT 125

  Fly   134 IPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHVNITIDMICA--- 195
            :.|......|||..|.||||.|.........:||.:...:|.:.||..:|.. .||.:|||.   
  Rat   126 VALPSSCAPAGTQCLISGWGNTLSLGVNNPDLLQCLDAPVLPQADCEASYPG-KITNNMICVGFL 189

  Fly   196 DGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCG--TNPGVYEDIAFFHNWIKYTVKKN 256
            :|.: |:||||||||::     .:.||.|:||||.||.  .|||||..:..:.:||:.|:..|
  Rat   190 EGGK-DSCQGDSGGPVV-----CNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQDTIAAN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 80/230 (35%)
Tryp_SPc 29..250 CDD:238113 81/230 (35%)
Try5XP_008761147.1 Tryp_SPc 23..239 CDD:214473 80/230 (35%)
Tryp_SPc 24..242 CDD:238113 82/232 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.