DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and LOC101730924

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_031761513.1 Gene:LOC101730924 / 101730924 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:264 Identity:89/264 - (33%)
Similarity:133/264 - (50%) Gaps:36/264 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLSILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAH 69
            |||.:|:   |.|.|.    .:::|:||:......||:.||: |:..|.|||.:.:::.:::|||
 Frog     4 LLLCVLL---GAAAAF----DDDKIIGGATCAKNSVPYIVSL-NSGYHFCGGSLINNQWVVSAAH 60

  Fly    70 CLSNVTVTDLSVRAG--SSYWSKG-GQVLKVLKTIAHPKYVPKLYNPY----DIAVLILEAPLRL 127
            |..    ..:.||.|  :...|:| .|.:...|.|.|..     ||.:    ||.::.|.:...|
 Frog    61 CYK----ASIQVRLGEHNIALSEGTEQFISSSKVIRHSG-----YNSWTLDNDIMLIKLSSAASL 116

  Fly   128 GGTVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHVNITIDM 192
            ...|..:.|......|||..|.||||.|..:.|....:||.::..||....|..||.. .||.:|
 Frog   117 NAAVNAVALPSGCAAAGTSCLISGWGNTLSSGSNYPDLLQCLYAPILTDAQCNNAYPG-EITNNM 180

  Fly   193 IC---ADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGTN--PGVYEDIAFFHNWIKYT 252
            ||   .:|.: |:||||||||::     .:.||.|:||||.||...  ||||..:..:::||:.|
 Frog   181 ICLGFLEGGK-DSCQGDSGGPVV-----CNGQLQGVVSWGYGCAQRNYPGVYTKVCNYNSWIQST 239

  Fly   253 VKKN 256
            :..|
 Frog   240 IAAN 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 78/232 (34%)
Tryp_SPc 29..250 CDD:238113 79/232 (34%)
LOC101730924XP_031761513.1 Tryp_SPc 21..239 CDD:238113 80/234 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.