DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and prss59.2

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001268923.1 Gene:prss59.2 / 100535672 ZFINID:ZDB-GENE-110408-10 Length:242 Species:Danio rerio


Alignment Length:256 Identity:85/256 - (33%)
Similarity:129/256 - (50%) Gaps:26/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCLSN 73
            :.:.:.|.|.|.    .:::||||........|||.|: |:..|.|||.:.|:..:::||||.. 
Zfish     5 VFLVLLGAAFAL----DDDKIVGGYECQPNSQPWQASL-NSGYHFCGGSLVSEYWVVSAAHCYK- 63

  Fly    74 VTVTDLSVRAG--SSYWSKG-GQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGTVKKIP 135
               :.|.||.|  :...::| .|.:...|.|.:|.|.....:. ||.::.|..|..|...|:.:.
Zfish    64 ---SRLEVRLGEHNIVINEGTEQFITSEKVIRNPNYDSWTIDS-DIMLIKLSKPATLNKYVQPVA 124

  Fly   136 LAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHVNITIDMICA---DG 197
            |.......||:...||||.|..:::.. ..||.:.:.||:..||..:|..: ||..|.||   :|
Zfish   125 LPNGCAADGTMCRVSGWGNTMSSTADS-NKLQCLEIPILSDRDCKNSYPGM-ITDTMFCAGYLEG 187

  Fly   198 QRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCG--TNPGVYEDIAFFHNWIKYTVKKN 256
            .: |:||||||||::     .:.:|.|:||||.||.  .|||||..:..|..||..|::.|
Zfish   188 GK-DSCQGDSGGPVV-----CNGELQGIVSWGYGCAQKDNPGVYGKVCMFSQWIADTMRNN 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 78/228 (34%)
Tryp_SPc 29..250 CDD:238113 79/228 (35%)
prss59.2NP_001268923.1 Tryp_SPc 20..235 CDD:214473 78/228 (34%)
Tryp_SPc 21..238 CDD:238113 80/230 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.