DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31675 and CG6329

DIOPT Version :9

Sequence 1:NP_724298.1 Gene:CG31675 / 318879 FlyBaseID:FBgn0051675 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001286393.1 Gene:CG6329 / 36529 FlyBaseID:FBgn0033872 Length:155 Species:Drosophila melanogaster


Alignment Length:154 Identity:49/154 - (31%)
Similarity:71/154 - (46%) Gaps:21/154 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQHYLLLFGALISLLASAYAIKCYACESVYEASCGDDFEVENHFKYDCAFIAPPRFLENDLLSVN 65
            |:..|||.|.|..:..:. |:.||.|.|.::..|||.||..:..:.:|:...|...|::   ...
  Fly     5 MEKTLLLLGVLCCIQVTT-ALMCYDCNSEFDPRCGDPFEPYSIGEVNCSKQEPLEHLKD---KYK 65

  Fly    66 ATACLKRVFKENGVRKIVRGC-YFGEVNATDVWCKMDPTLSAVQNSSCH-----VCD-SENYCNG 123
            .|.|.|.|.|..|..:||||| |..:.| ||..|        |:.|..|     .|. :::.|||
  Fly    66 PTLCRKTVQKIYGKTRIVRGCGYIPDEN-TDNKC--------VRRSGTHDVAAIYCSCTKDLCNG 121

  Fly   124 SENHPVDKWKIFGSLVLFLLATQL 147
            : |.|..:|.:...:|...||..|
  Fly   122 A-NSPAGQWMMLPLIVAAGLALLL 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31675NP_724298.1 None
CG6329NP_001286393.1 QVR 24..120 CDD:407231 32/107 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33562
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.