DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31675 and CG9336

DIOPT Version :9

Sequence 1:NP_724298.1 Gene:CG31675 / 318879 FlyBaseID:FBgn0051675 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_610069.2 Gene:CG9336 / 35355 FlyBaseID:FBgn0032897 Length:148 Species:Drosophila melanogaster


Alignment Length:144 Identity:58/144 - (40%)
Similarity:82/144 - (56%) Gaps:6/144 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLFGALISLLASAYAIKCYACESVYEASCGDDFEVENHFKYDCAFIAPPRFLENDLLSVNATACL 70
            |....:|||..||||||||.|||:....||..||.:.....||:.|.|||:|:|.....|||.|:
  Fly     9 LAVAVMISLACSAYAIKCYQCESLTMPKCGLKFEADETLLLDCSRIGPPRYLQNFFPLRNATGCM 73

  Fly    71 KRVFKE-NGVRKIVRGCYFGEVNATDVWCKMDPTLSAVQNSSCHVCDSENYCNGSENHPVDKWKI 134
            |:..:. .|..:|||.||||::|.....|:.||::..|:...|.|| :::.||||.:..    .|
  Fly    74 KKTLESVAGHPQIVRSCYFGDINNIQAGCQSDPSMPFVKQLGCDVC-TKDECNGSSSLA----PI 133

  Fly   135 FGSLVLFLLATQLL 148
            .|:::||....:||
  Fly   134 AGAILLFFGVARLL 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31675NP_724298.1 None
CG9336NP_610069.2 QVR 24..125 CDD:407231 40/101 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147170at50557
OrthoFinder 1 1.000 - - FOG0012691
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33562
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.