DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31675 and twit

DIOPT Version :10

Sequence 1:NP_724298.1 Gene:CG31675 / 318879 FlyBaseID:FBgn0051675 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_610067.1 Gene:twit / 35353 FlyBaseID:FBgn0032895 Length:166 Species:Drosophila melanogaster


Alignment Length:163 Identity:38/163 - (23%)
Similarity:59/163 - (36%) Gaps:46/163 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FGALISLLASAYAI------------KCYACES---VYEASCGDDFEVENHFKYDCAFIAPPRFL 57
            |.|.:.|||:|:.|            :|:.|.|   ..|..|...|:.:|         .|...:
  Fly     9 FLAGLFLLANAWHITAINEQHQKHHLQCWHCSSDTIGAEDFCDVTFQEDN---------IPTDLI 64

  Fly    58 E----NDLLSVNAT--------ACLKRVFKENGVRKIVRGCYFGEVNATDVWCKMDPTLSAVQNS 110
            :    |.|.|.|.|        .|.|.|.:.||.....|.||:...:.....|.:......|:..
  Fly    65 KERNINLLRSCNGTINSDHERAVCRKTVEENNGKLITKRFCYYTNKSDPVELCNITSPEKNVRRI 129

  Fly   111 SCHVCDSENYCNGSENHPVDKWKIFGSLVLFLL 143
            .|..|.::. |||:         :.|:.:|.:|
  Fly   130 FCEDCLTDR-CNGA---------LAGASILEML 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31675NP_724298.1 TFP 20..124 CDD:480272 28/130 (22%)
twitNP_610067.1 TFP_LU_ECD_Twit 33..142 CDD:467122 27/118 (23%)

Return to query results.
Submit another query.