DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31675 and CG31676

DIOPT Version :9

Sequence 1:NP_724298.1 Gene:CG31675 / 318879 FlyBaseID:FBgn0051675 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001286113.1 Gene:CG31676 / 35351 FlyBaseID:FBgn0051676 Length:159 Species:Drosophila melanogaster


Alignment Length:136 Identity:40/136 - (29%)
Similarity:63/136 - (46%) Gaps:29/136 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLFGALISLL-----ASAYAIKCYACESVYEAS----CGDDF------EVENHFKY-DCAFIAPP 54
            ||.| |.|||     ||| .::|:.|.:  :.|    |.|.|      |.:.::.| :|.:....
  Fly     9 LLLG-LFSLLMVFNTASA-VLRCWRCST--DVSNGEFCNDPFMPETISEQQRYWSYVNCTYSVGA 69

  Fly    55 RFLENDLLSVNA-TACLKRVFKENGVRKIVRGCYFGEVNATDVWCKMDPTLSAVQNSSCHVCDSE 118
            :       |||| ..|.|.|.:..|.|.|.|.|::.:::.:...|..|.|.|.::...|..|.::
  Fly    70 K-------SVNARPVCKKLVQEVYGKRVISRSCFYEDMDDSADKCANDQTSSYIKTVYCRTCTTD 127

  Fly   119 NYCNGS 124
            . |||:
  Fly   128 G-CNGA 132



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33562
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.