DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31675 and K11H12.6

DIOPT Version :9

Sequence 1:NP_724298.1 Gene:CG31675 / 318879 FlyBaseID:FBgn0051675 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001368205.1 Gene:K11H12.6 / 187313 WormBaseID:WBGene00019662 Length:134 Species:Caenorhabditis elegans


Alignment Length:131 Identity:38/131 - (29%)
Similarity:52/131 - (39%) Gaps:29/131 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFGALISLLASAYAIKCYACESVYEASCGDDFEVENHFKYDCAFIAPPRFLENDLLSVNATACLK 71
            ||.....|.|.:..:.||.|.|..:..|.|:::..|       .|.|.|.|....|. ....|  
 Worm     3 LFIVFAPLFAVSAPLNCYICNSKKQPDCIDNYQAFN-------TICPVRSLGGVKLH-EPVGC-- 57

  Fly    72 RVFKENGVRK--IVRGC-YFGEVNATDVWCKMDPT--LSAVQN------SSCHVCDSENYCNGSE 125
            ||.::....|  |:|.| |.||....    |.:.|  |:.|:.      |.|    |||.||.:|
 Worm    58 RVTRQYSKEKMWIIRECGYLGEERER----KFNTTTYLNGVKEPATCVFSQC----SENLCNSAE 114

  Fly   126 N 126
            :
 Worm   115 S 115



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR33562
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.