DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31675 and C15H9.9

DIOPT Version :9

Sequence 1:NP_724298.1 Gene:CG31675 / 318879 FlyBaseID:FBgn0051675 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_509029.1 Gene:C15H9.9 / 180885 WormBaseID:WBGene00015803 Length:137 Species:Caenorhabditis elegans


Alignment Length:156 Identity:42/156 - (26%)
Similarity:55/156 - (35%) Gaps:40/156 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FGALISLLASAYA-IKCYACESVYEASC--GDDFEVENHFKYDCAFIAPPRFLENDLLSVNATAC 69
            |..|.||.....| |.||.|.|....:|  .||..:| .||..|..:....|..|     .|..|
 Worm     6 FVLLASLALGVSANISCYQCTSNENPTCDANDDGALE-AFKKTCTPLTEGTFKGN-----AAVGC 64

  Fly    70 LKRVFKENGVRKIVRGC-YFGEVNATDVWCKMDPTLSAVQNSSCHV-------CDSENY---CNG 123
            .|......||..:||.| |.||            .:..::.:..|.       |::|..   ||.
 Worm    65 RKITQSVEGVLSVVRECAYSGE------------PVDGLKKTGNHAIRIHYYQCENEKAGTPCNS 117

  Fly   124 SENHPVDKWKIFGSL-VLFLLATQLL 148
            ...       :|..| :|.|:|..||
 Worm   118 VAG-------VFSPLSILSLIAIYLL 136



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR33562
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.