DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31675 and K11H12.7

DIOPT Version :10

Sequence 1:NP_724298.1 Gene:CG31675 / 318879 FlyBaseID:FBgn0051675 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_499966.1 Gene:K11H12.7 / 176893 WormBaseID:WBGene00019663 Length:127 Species:Caenorhabditis elegans


Alignment Length:128 Identity:39/128 - (30%)
Similarity:57/128 - (44%) Gaps:26/128 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YLLLFGALISLLASAYAIKCYACESVYEASCGDDFEVENHFKYDCAFIAPPRFLENDLLSVNATA 68
            :|::|.   ||.|.:.|:.||.|.|:.:..|     |.|:.|::  .|.|.:.. ..:.||....
 Worm     3 FLIVFA---SLFAVSAALNCYICNSLNQPEC-----VHNYEKFN--KICPVKSF-GGMKSVKPLG 56

  Fly    69 C--LKRVFKENGVRKIVRGC-YFGEVNATDVWCKMDPTLSAVQN--SSCHVCDSENYCNGSEN 126
            |  .::..||.  ..|||.| |.||    |:..|.:.....|..  |.|    |||.||.:|:
 Worm    57 CRVSRQYVKEE--TSIVRECAYTGE----DIERKSNKGSLGVSRVYSQC----SENLCNSAES 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31675NP_724298.1 TFP 20..124 CDD:480272 33/108 (31%)
K11H12.7NP_499966.1 TFP 15..106 CDD:480272 32/108 (30%)

Return to query results.
Submit another query.