DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31674 and FDH1

DIOPT Version :9

Sequence 1:NP_001286111.1 Gene:CG31674 / 318878 FlyBaseID:FBgn0051674 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_015033.1 Gene:FDH1 / 854570 SGDID:S000005915 Length:376 Species:Saccharomyces cerevisiae


Alignment Length:320 Identity:87/320 - (27%)
Similarity:147/320 - (45%) Gaps:45/320 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LKEQ-CEILQVINEPPKNRPEILEKIRGAHAVI-------WGGRDILNAEILDAAGPQLKAVSTM 80
            ::|| .|::..|::.|:....:..:::.|..||       :..|:.:      |..|.||...|.
Yeast    37 IEEQGYELVTTIDKDPEPTSTVDRELKDAEIVITTPFFPAYISRNRI------AEAPNLKLCVTA 95

  Fly    81 SSGINNVDVPELKKRGIPLGSTPAMLTVAVADLTVGLLIAAARRFQEGRRKIDSDKWD-----KD 140
            ..|.::||:....:|.|.:........|:||:..:..::...|.:..|.::..:.:||     |:
Yeast    96 GVGSDHVDLEAANERKITVTEVTGSNVVSVAEHVMATILVLIRNYNGGHQQAINGEWDIAGVAKN 160

  Fly   141 HLNWMLGQDIRDSTVGFYGFGGIGQAVAKRLMGFDIKRMLYTTRNRVSQDIEERFN-AKKV---- 200
            .      .|:.|..:...|.|.||..|.:||:.|:.|::||.....:..:...|.| |.|:    
Yeast   161 E------YDLEDKIISTVGAGRIGYRVLERLVAFNPKKLLYYDYQELPAEAINRLNEASKLFNGR 219

  Fly   201 --------DFETLLAESDFLIIASPLTKETLGLFNATVFNKMKETAVLVNVGRGKIVNQDDLYEA 257
                    ..|.::|:||.:.|..||.|::.||||..:.:.||:.|.|||..||.|...:|:.||
Yeast   220 GDIVQRVEKLEDMVAQSDVVTINCPLHKDSRGLFNKKLISHMKDGAYLVNTARGAICVAEDVAEA 284

  Fly   258 LKSNRIFAAGLDVMDPEPLPSNDKLLTLDNVVVTPHVGYA----TRRTRVDAANLASRNV 313
            :||.::...|.||.|.:|.|.:....|:||   ..|||.|    ...|.:||....::.|
Yeast   285 VKSGKLAGYGGDVWDKQPAPKDHPWRTMDN---KDHVGNAMTVHISGTSLDAQKRYAQGV 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31674NP_001286111.1 GDH 8..319 CDD:240626 87/320 (27%)
LdhA 9..321 CDD:223980 87/320 (27%)
FDH1NP_015033.1 FDH 4..371 CDD:240627 87/320 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53501
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.