DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31674 and SPCC364.07

DIOPT Version :9

Sequence 1:NP_001286111.1 Gene:CG31674 / 318878 FlyBaseID:FBgn0051674 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_587837.1 Gene:SPCC364.07 / 2539490 PomBaseID:SPCC364.07 Length:466 Species:Schizosaccharomyces pombe


Alignment Length:345 Identity:94/345 - (27%)
Similarity:162/345 - (46%) Gaps:51/345 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TTKPF-----KVLIAHTDVPPEGIEILKE---QCEILQVINEPPKNRPEILEKIRGAHAVIWGGR 59
            |.|||     |:|:.. :|....:..||:   |.|.|:.    ..:..:::|||:|.||:....:
pombe    47 TLKPFASEDIKILLLE-NVNQSALSNLKDEGYQVEFLKT----SMSEDDLVEKIKGVHAIGIRSK 106

  Fly    60 DILNAEILDAAGPQLKAVSTMSSGINNVDVPELKKRGIPLGSTPAMLTVAVADLTVGLLIAAARR 124
            ..|...:|:|| ..|..:.....|.|.||:....:|||.:.::|...:.:||:|.:|.:|:.||:
pombe   107 TRLTRRVLEAA-DSLIVIGCFCIGTNQVDLDFAAERGIAVFNSPYANSRSVAELVIGYIISLARQ 170

  Fly   125 FQEGRRKIDSDKWDKDHLN-WMLGQDIRDSTVGFYGFGGIGQ--AVAKRLMGFDIKRMLYTTRNR 186
            ..:...::...:|:|.... |    :||..|:|..|:|.||.  :|....||..:          
pombe   171 VGDRSLELHRGEWNKVSSGCW----EIRGKTLGIIGYGHIGSQLSVLAEAMGLHV---------- 221

  Fly   187 VSQDIEERF---NAKKV-DFETLLAESDFLIIASPLTKETLGLFNATVFNKMKETAVLVNVGRGK 247
            |..||....   :||:: ....||..:||:.:..|.:.||..:.::..|..|||.:.|:|..||.
pombe   222 VYYDILPIMPLGSAKQLSSLPELLHRADFVSLHVPASPETKNMISSKEFAAMKEGSYLINASRGT 286

  Fly   248 IVNQDDLYEALKSNRIFAAGLDVMDPEPLPS-NDK-----------LLTLDNVVVTPHVGYATRR 300
            :|:...|.:|.||.:|..|.:||...||..: .||           |....|:::|||:|.:|..
pombe   287 VVDIPALVDASKSGKIAGAAIDVYPSEPAGNGKDKFVDSLNSWTSELTHCKNIILTPHIGGSTEE 351

  Fly   301 TR----VDAANLASRNVLKG 316
            .:    ::.:...:|.:.:|
pombe   352 AQYNIGIEVSEALTRYINEG 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31674NP_001286111.1 GDH 8..319 CDD:240626 90/335 (27%)
LdhA 9..321 CDD:223980 89/334 (27%)
SPCC364.07NP_587837.1 PRK11790 54..466 CDD:236985 90/338 (27%)
PGDH_3 56..367 CDD:240653 88/330 (27%)
ACT_3PGDH 396..465 CDD:153173
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53501
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.