DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and SWF1

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_010411.1 Gene:SWF1 / 851704 SGDID:S000002533 Length:336 Species:Saccharomyces cerevisiae


Alignment Length:228 Identity:66/228 - (28%)
Similarity:99/228 - (43%) Gaps:55/228 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FAW---IVLLLTTFLFFFYPCQFY------VKSHPWVLAYQGVITFFVLANFTLATFMDPGIIPK 70
            :.|   :|.|..|.::.:....::      :|:..::|....::...:|....|      ||:..
Yeast    47 YRWKLHLVPLFYTSIYLYLVYTYHMRVESTIKNELFLLERILIVPIIILPPVAL------GILAM 105

  Fly    71 ASPDEDCEEE-------------LRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCI 122
            .|..||.::.             |..|..|             |.||:..:|.|..|||:||.|:
Yeast   106 VSRAEDSKDHKSGSTEEYPYDYLLYYPAIK-------------CSTCRIVKPARSKHCSICNRCV 157

  Fly   123 ETFDHHCPWVNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVY--VLKIMPNIKDTAP---IVAI 182
            ...||||.|:|||||:.||..|:.||:|      :|||:|..:  :..|..|...|.|   :...
Yeast   158 LVADHHCIWINNCIGKGNYLQFYLFLIS------NIFSMCYAFLRLWYISLNSTSTLPRAVLTLT 216

  Fly   183 ILMGLVTILAIPIFGLTGFHMVLVSRGRTTNEQ 215
            ||.|..||:. .||  |...:.:|..|.|||||
Yeast   217 ILCGCFTIIC-AIF--TYLQLAIVKEGMTTNEQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 50/127 (39%)
SWF1NP_010411.1 COG5273 22..336 CDD:227598 66/228 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R405
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.