DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and ERF2

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_013347.1 Gene:ERF2 / 850947 SGDID:S000004236 Length:359 Species:Saccharomyces cerevisiae


Alignment Length:254 Identity:69/254 - (27%)
Similarity:113/254 - (44%) Gaps:48/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LLTTFLFFFYPCQFYVKSHPWVLAYQGVITFFVLANFTLATFMDPGIIPKASPDEDCEEELRAPL 85
            :|..|.::|           ||:         .||:|......|||::|:...........:.| 
Yeast   108 VLVIFFYYF-----------WVI---------TLASFIRTATSDPGVLPRNIHLSQLRNNYQIP- 151

  Fly    86 YKNAEINGIT----------VKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPWVNNCIGRRN 140
              ....|.||          :.:|:|.:|:.:||||.||||.||.|:...||||.|||||||:||
Yeast   152 --QEYYNLITLPTHSSISKDITIKYCPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRN 214

  Fly   141 YRFFFFFLVSLSIHMLSIFSLCLVYVLKIMPNIKDTAPIVAIILMGLVTILAIPIFGLTGFHMVL 205
            ||||..||:...:..:.:.:.|.:::.:.....:| .|:..::|......|..|....| :|:.:
Yeast   215 YRFFLIFLLGAILSSVILLTNCAIHIARESGGPRD-CPVAILLLCYAGLTLWYPAILFT-YHIFM 277

  Fly   206 VSRGRTTNEQVTGKFKGGYNP-----------FSRGCW-HNCCYTQFGPQYPSLLNPKK 252
            ....:||.|.:.| .....||           :::|.: .|..:....|:.||.::.:|
Yeast   278 AGNQQTTREFLKG-IGSKKNPVFHRVVKEENIYNKGSFLKNMGHLMLEPRGPSFVSARK 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 46/134 (34%)
ERF2NP_013347.1 COG5273 47..359 CDD:227598 69/254 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I1540
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000285
OrthoInspector 1 1.000 - - otm46915
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R405
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.