DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and ZDHHC16

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:XP_006718084.1 Gene:ZDHHC16 / 84287 HGNCID:20714 Length:384 Species:Homo sapiens


Alignment Length:280 Identity:70/280 - (25%)
Similarity:110/280 - (39%) Gaps:74/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RYIPATFAWIVLLLT-TFLFFFYPC-------QFYVKSHPWVLAYQGVITFFVLANFTLATFMDP 65
            |:....|..:|::|| :.:...|.|       .:.|....|...|.......::.::..|....|
Human    77 RWFGVVFVVLVIVLTGSIVAIAYLCVLPLILRTYSVPRLCWHFFYSHWNLILIVFHYYQAITTPP 141

  Fly    66 GIIPKASPDEDCEEELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCP 130
            |..|:...|                |..:::    |..|.:.:|.|..|||:||.|:...|||||
Human   142 GYPPQGRND----------------IATVSI----CKKCIYPKPARTHHCSICNRCVLKMDHHCP 186

  Fly   131 WVNNCIGRRNYRFFF---FFL----VSLSIHMLSIFSLCLVYVLKIMPNIKDTAPIVA------- 181
            |:|||:|..|:|:||   ||:    |..|.....:|......:.|:....|:....||       
Human   187 WLNNCVGHYNHRYFFSFCFFMTLGCVYCSYGSWDLFREAYAAIEKMKQLDKNKLQAVANQTYHQT 251

  Fly   182 ----------------IILMGLVTI-------LAIPIFGLTGFHMVLVSRGRTTNEQVTGK---- 219
                            :.|..|.::       :|:.:..||.:|.||:|||.|:.|:...|    
Human   252 PPPTFSFRERMTHKSLVYLWFLCSLRPSFLSSVALALGALTVWHAVLISRGETSIERHINKKERR 316

  Fly   220 ---FKGGY--NPFSRGCWHN 234
               .||..  ||::.||..|
Human   317 RLQAKGRVFRNPYNYGCLDN 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 46/161 (29%)
ZDHHC16XP_006718084.1 zf-DHHC 155..312 CDD:279823 46/160 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.