DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and ZDHHC18

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_115659.1 Gene:ZDHHC18 / 84243 HGNCID:20712 Length:388 Species:Homo sapiens


Alignment Length:285 Identity:108/285 - (37%)
Similarity:159/285 - (55%) Gaps:43/285 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IVLLLTTFLFFFYPCQFYVK----SHPWVLAYQGVITFFVLANFTLATFMDPGIIPKASPDEDCE 78
            :::|.||.|||.:.|.:..:    :.|.:.|   ::.|||::.....:|.||||:|:|:..|...
Human    99 LLILTTTGLFFVFDCPYLARKLTLAIPIIAA---ILFFFVMSCLLQTSFTDPGILPRATVCEAAA 160

  Fly    79 EELR-----------APLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPWV 132
            .|.:           .|..:...|||..||:|:|.|||.:||||.||||||::|:|.||||||||
Human   161 LEKQIDNTGSSTYRPPPRTREVLINGQMVKLKYCFTCKMFRPPRTSHCSVCDNCVERFDHHCPWV 225

  Fly   133 NNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYVLKI-------MPNIKDTAPIVAIILMGLVTI 190
            .||:||||||||:.|::|||.....||: |:|..|.:       :..:|:|...|..:::...:|
Human   226 GNCVGRRNYRFFYAFILSLSFLTAFIFA-CVVTHLTLRAQGSNFLSTLKETPASVLELVICFFSI 289

  Fly   191 LAIPIFGLTGFHMVLVSRGRTTNEQVTGKF---KGG---YNPFS-RGCWHNCCYTQFGPQYPSLL 248
            .:  |.||:|||..||:...||||.:.|.:   :||   .||:| :....|||....||..|||:
Human   290 WS--ILGLSGFHTYLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSIITNCCAVLCGPLPPSLI 352

  Fly   249 NPKKYASRRSQVQNQAI--STICND 271
            :      ||..||:..:  |.|.:|
Human   353 D------RRGFVQSDTVLPSPIRSD 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 62/131 (47%)
ZDHHC18NP_115659.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..67
zf-DHHC 191..314 CDD:279823 60/125 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..388 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264614at2759
OrthoFinder 1 1.000 - - FOG0000285
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R405
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.