DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and AT5G50020

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001190503.1 Gene:AT5G50020 / 835066 AraportID:AT5G50020 Length:444 Species:Arabidopsis thaliana


Alignment Length:274 Identity:100/274 - (36%)
Similarity:146/274 - (53%) Gaps:45/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IPATFAWIVLLLTTFLFFFYPCQFYVKSH----------PWVLAYQGVI-TFFVLANFTLATFMD 64
            ||.||   :|::|...||    ..:|.:|          ..|....||: |.|||....|.:..|
plant    60 IPFTF---LLIITPVCFF----SVFVATHLRRELLPNNAGHVFLVAGVLFTVFVLILLFLTSARD 117

  Fly    65 PGIIPKAS--PDED-CEE-----------ELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHC 115
            |||:|:.|  |:|: |.:           .::.|..|...:.|::|::|:|.||..|||||||||
plant   118 PGIVPRNSHPPEEELCYDTTVSSDGRQTPTVQIPRTKEVMVYGVSVRVKYCDTCMLYRPPRCSHC 182

  Fly   116 SVCNHCIETFDHHCPWVNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYVLKIMPNIKDT---- 176
            |:||:|:|.||||||||..|||.||||:||.|:.|.:|..:.|||:..:|:..:|.|.:.|    
plant   183 SICNNCVERFDHHCPWVGQCIGVRNYRYFFMFVSSATILCIYIFSMSALYIKVLMDNHQGTVWRA 247

  Fly   177 ---APIVAIILMGLVTILAIPIFGLTGFHMVLVSRGRTTNEQVTGKFKGGYNPFSRGCWHNCCYT 238
               :| .|::||....|....:.||||||:.|:|..:||.|....:.....|.::|||.:|    
plant   248 MRESP-WAVMLMIYCFISLWFVGGLTGFHLYLISTNQTTYENFRYRSDNRINVYNRGCSNN---- 307

  Fly   239 QFGPQYPSLLNPKK 252
             |...:.|.:.|.:
plant   308 -FFETFCSKVKPSR 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 62/131 (47%)
AT5G50020NP_001190503.1 Cation_efflux <23..114 CDD:279834 18/60 (30%)
zf-DHHC 166..291 CDD:279823 61/125 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264614at2759
OrthoFinder 1 1.000 - - FOG0000285
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.