DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and AT5G41060

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_198922.1 Gene:AT5G41060 / 834108 AraportID:AT5G41060 Length:410 Species:Arabidopsis thaliana


Alignment Length:315 Identity:104/315 - (33%)
Similarity:147/315 - (46%) Gaps:39/315 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RYIPATFAWIVLLLTTFLFFFYPCQFYVKSHPW---VLAYQGVITFFVLANFTLATFMDPGIIPK 70
            |.:..|.:.||..:|.|..|.........|..|   ::....|.|.:.|....|.:..||||||:
plant    43 RSLGLTISLIVAPVTIFCIFVASKLMDDFSDSWGVSIILVAVVFTIYDLILLMLTSGRDPGIIPR 107

  Fly    71 ASPDEDCE-----------EELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIET 124
            .|...:.|           :..|.|..|..|:||...|:|:|.||..||||||||||:||:|:|.
plant   108 NSHPPEPEVVDGNTGSGTSQTPRLPRVKEVEVNGKVFKVKYCDTCMLYRPPRCSHCSICNNCVER 172

  Fly   125 FDHHCPWVNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYVLKIMPN---------IKDTAPIV 180
            ||||||||..||.:|||||||.|:.|.::..:.:|:.|.||:.||..:         :|..|.|.
plant   173 FDHHCPWVGQCIAQRNYRFFFMFVFSTTLLCVYVFAFCCVYIKKIKESEDISILKAMLKTPASIA 237

  Fly   181 AIILMGLVTILAIPIFGLTGFHMVLVSRGRTTNEQVTGKFKGGYNPFSRGCWHNCCYTQFGPQYP 245
            .|:...:.|..   :.|||.||:.|:|..:||.|.....:....||.::|...|.....|.|..|
plant   238 LILYTFISTFF---VGGLTCFHLYLISTNQTTYENFRYSYDRHSNPHNKGVVDNFKEIFFSPIPP 299

  Fly   246 SLLNPKKYASRRSQVQNQAI--------STICND-----RSGQQTGAGSGAGGNG 287
            |..|.:....|.:.:.::::        ....||     |.|....|..|.|.:|
plant   300 SKNNFRAMVPRENPMPSRSVVGGFMSPNMGKANDDIEMGRKGVWAMAEHGDGKDG 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 59/133 (44%)
AT5G41060NP_198922.1 DHHC 147..273 CDD:396215 58/128 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264614at2759
OrthoFinder 1 1.000 - - FOG0000285
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.