DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and AT5G05070

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_196126.2 Gene:AT5G05070 / 830389 AraportID:AT5G05070 Length:413 Species:Arabidopsis thaliana


Alignment Length:294 Identity:93/294 - (31%)
Similarity:142/294 - (48%) Gaps:44/294 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLLTTFLFFFYPCQFYVKSHPWVLAYQGVITFFVLA--------NFT---LATFMDPGIIPKASP 73
            |.||:||.......|.::...|:........:.|||        :||   |.:..||||||:...
plant    63 LYLTSFLIGAPALTFCIRMLVWIKRGDPFFNYTVLASGFILTLLDFTFLMLTSARDPGIIPRNKT 127

  Fly    74 DEDCEEE------------------LRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNH 120
            ....|::                  |:.|..|:..:||.|:|:|:|.||..|||||.||||:||:
plant   128 SMILEDDSDSSLTQSMEWVNNKTPNLKIPRTKDVFVNGYTIKVKFCDTCLLYRPPRASHCSICNN 192

  Fly   121 CIETFDHHCPWVNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYVL----KIMPNIKDTAPIVA 181
            |::.||||||||..||.||||.||..|:.|.::..:.:|....:.::    |:...:.|  .||:
plant   193 CVQRFDHHCPWVGQCIARRNYPFFICFISSSTLLCIYVFVFSWINLIRQPGKLWRTMSD--DIVS 255

  Fly   182 IILMGLVTILAIPIFGLTGFHMVLVSRGRTTNEQVTGKFKGGYNPFSRGCWHNCCYTQFGPQYPS 246
            :||:....:....:.|||.||..|:|..:||.|....::....||:.||...|.....|....||
plant   256 VILIVYTFVAVWFVGGLTIFHFYLMSTNQTTYENFRYRYDKKENPYKRGLLKNVKEVLFAKIPPS 320

  Fly   247 LLN-----PKK----YASRRSQVQNQAISTICND 271
            .|:     |::    .||..|:.:::..|::..|
plant   321 QLDLRAMVPEEDDMTIASNDSEYESEYTSSVRYD 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 53/128 (41%)
AT5G05070NP_196126.2 zf-DHHC 171..292 CDD:279823 51/122 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264614at2759
OrthoFinder 1 1.000 - - FOG0000285
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.