DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and AT5G04270

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_196047.3 Gene:AT5G04270 / 830306 AraportID:AT5G04270 Length:271 Species:Arabidopsis thaliana


Alignment Length:233 Identity:64/233 - (27%)
Similarity:97/233 - (41%) Gaps:36/233 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FAWIVLLLTTFLFFFYPCQFYVKSHPWV-----LAYQGVITFFVLA-----NFTLATFMDPGIIP 69
            |:..|||:...:.|.|....:|....||     ......:.|.:||     :.::...:|||.:|
plant     7 FSIPVLLVILVMGFVYYVTLFVFIDDWVGLQSSAGKLNALLFSLLASLCLFSLSICVLVDPGRVP 71

  Fly    70 KASPDEDCEEELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPWVNN 134
             ||...|.|:        :...|....:.:.|..|..|:|.|..||.||..|:...||||.|:||
plant    72 -ASYAPDVED--------SGWSNSNVTETRKCDKCFAYKPLRTHHCRVCRRCVLKMDHHCLWINN 127

  Fly   135 CIGRRNYRFFF---FFLVSLSIHMLSIFSLCLVYVLKIMPNIKDTAPI-VAIILMGLVTI-LAIP 194
            |:|..||:.||   |:....||:...:...|   ..|...:.....|: ..|:..|:..| |:|.
plant   128 CVGYANYKAFFILVFYATVASIYSTVLLVCC---AFKNGDSYAGNVPLKTFIVSCGIFMIGLSIT 189

  Fly   195 IFGLTGFHMVLVSRGRTTNEQVTGKFKGGYNPFSRGCW 232
            :..|..:|:.|::...||.|....|         |..|
plant   190 LGTLLCWHIYLITHNMTTIEHYDSK---------RASW 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 40/129 (31%)
AT5G04270NP_196047.3 DHHC 90..211 CDD:396215 40/123 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.