DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and AT4G00840

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_567193.2 Gene:AT4G00840 / 826193 AraportID:AT4G00840 Length:291 Species:Arabidopsis thaliana


Alignment Length:239 Identity:59/239 - (24%)
Similarity:94/239 - (39%) Gaps:62/239 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 WIVLL------------LTTFLFFFYPCQFYVKSHPWVLAYQGVITFFVLANFTLATFMDPGIIP 69
            |.:|:            |..|:|.|                   :...:|.::....|.|||.:|
plant    38 WPILIRGDHGALSALAALIIFVFHF-------------------LLIMLLWSYFTTVFTDPGSVP 83

  Fly    70 KASPDEDCEEELRAPLYKNAEI-------NGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDH 127
                     |..|..:.....:       .|....:.:|..|:..:||||.|||||..|:...||
plant    84 ---------EHFRREMGGGDSLEAGTSTDQGAFGSLGYCTKCRNVKPPRCHHCSVCQRCVLKMDH 139

  Fly   128 HCPWVNNCIGRRNYRFFFFFLVSLSIH-MLSIFSLCLVYVLKIMPNIKDT------APIVAIILM 185
            ||.|:.||:|.|||:||..||....:. ||.:..|...::......||.:      |.:|...::
plant   140 HCVWIVNCVGARNYKFFLLFLFYTFLETMLDVIVLLPSFIEFFSQAIKHSSSPGKLASLVLAFVL 204

  Fly   186 GLVTILAIPIFGLTGFHMVLVSRGRTT------NEQVTGKFKGG 223
            ....:|::..|.:  .|:.|:|...|:      |.:|..|:..|
plant   205 NFAFVLSLLCFVV--MHISLLSSNTTSVEVHEKNGEVRWKYDLG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 42/137 (31%)
AT4G00840NP_567193.2 zf-DHHC 4..266 CDD:303066 59/239 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.