DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and AT3G56920

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_191251.2 Gene:AT3G56920 / 824859 AraportID:AT3G56920 Length:338 Species:Arabidopsis thaliana


Alignment Length:259 Identity:85/259 - (32%)
Similarity:123/259 - (47%) Gaps:29/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLLTTFLFFFYPCQFYVK-------SHPWV--LAYQGVI--TFFVLANFTLATFMDPGIIPKAS- 72
            |||||.:.......|.::       .||:.  |...|.|  ||.......|.:..||||||:.. 
plant    36 LLLTTCMIGGPAIAFSIRMAYLISHRHPFFHSLTLIGAILLTFMAFTFLFLTSSRDPGIIPRNKQ 100

  Fly    73 ------PDEDCEE---------ELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCI 122
                  ||...:.         .::.|..|:..:||.|||:|:|.||:.|||||..|||:||:|:
plant   101 VSEAEIPDVTTQSTEWVTSKLGSVKLPRTKDVMVNGFTVKVKFCDTCQLYRPPRAFHCSICNNCV 165

  Fly   123 ETFDHHCPWVNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYVLKIMPNIKDT-APIVAIILMG 186
            :.||||||||..||..|||.||..||...::..:.:|....|.:||:....... |..:.:.::|
plant   166 QRFDHHCPWVGQCIALRNYPFFVCFLSCSTLLCIYVFVFSWVSMLKVHGEFYVVLADDLILGVLG 230

  Fly   187 LVTILAI-PIFGLTGFHMVLVSRGRTTNEQVTGKFKGGYNPFSRGCWHNCCYTQFGPQYPSLLN 249
            |...::: .:.|||.||..|:...:||.|.....:....||:.:|...|.....|....|.|:|
plant   231 LYCFVSVWFVGGLTVFHFYLICTNQTTCENFRYHYDKKENPYRKGILENFKELFFAKIPPPLIN 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 51/126 (40%)
AT3G56920NP_191251.2 zf-DHHC 142..263 CDD:279823 48/120 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264614at2759
OrthoFinder 1 1.000 - - FOG0000285
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.