DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and zdhhc15b

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001071249.1 Gene:zdhhc15b / 777734 ZFINID:ZDB-GENE-061110-106 Length:332 Species:Danio rerio


Alignment Length:252 Identity:67/252 - (26%)
Similarity:110/252 - (43%) Gaps:49/252 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FAWI-------VLLLTTFLFFFYPCQFYVKSHPWVLAYQGVITFFVLANFTLATFMDPGIIPKAS 72
            |:||       |:|.:.:.:.|..|...:.::...:.|  ::.|.|.......|:......|.::
Zfish    14 FSWIPVIIISSVVLWSYYAYVFELCFVTLSNNLGRVTY--LLIFHVCFIMFCWTYWKAIFTPPST 76

  Fly    73 PDE------------DCEEE------------LRAPLYKNAEINGITVKMKWCVTCKFYRPPRCS 113
            |.:            :.||.            .:.|::..|:...|    ::|..|:..:|.||.
Zfish    77 PTKKFHLSYTDKERYEMEERPEVQKQILVDIAKKLPIFTRAQSGAI----RFCDRCQVIKPDRCH 137

  Fly   114 HCSVCNHCIETFDHHCPWVNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYVLKI----MPNIK 174
            |||||..|:...||||||||||:|..||:||..||....|:.:.|.|....|.||.    :||  
Zfish   138 HCSVCETCVLKMDHHCPWVNNCVGFSNYKFFLLFLSYSMIYCVFIASTVFQYFLKFWVGDLPN-- 200

  Fly   175 DTAPIVAIILMGLVTILAIPIFGLTGFHMVLVSRGRTTNEQVT------GKFKGGYN 225
            ..|....:.|:.:..:..:.:..|.|:|..||::.|:|.|..:      |..:.|:|
Zfish   201 GPAKFHVLFLLFVALMFFVSLMFLFGYHCWLVAKNRSTLEAFSPPVFQNGPDRNGFN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 47/134 (35%)
zdhhc15bNP_001071249.1 zf-DHHC 16..292 CDD:303066 66/250 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.