DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and zdhhc3b

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001071225.1 Gene:zdhhc3b / 777709 ZFINID:ZDB-GENE-061110-19 Length:300 Species:Danio rerio


Alignment Length:217 Identity:59/217 - (27%)
Similarity:92/217 - (42%) Gaps:47/217 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ATFAWIVLLLTTFLFFF---YPCQFYVKSHPWVLAYQGV-------ITFFVLANFTLATFMDPGI 67
            |...|:::|...|:..|   .|.:        .|.|..:       :.|..||:...|...|||.
Zfish    49 AVITWLLVLYAEFVVVFVMLLPAR--------SLLYSFINGALFNSLAFLALASHLRAMCTDPGA 105

  Fly    68 IPKASPDEDCEEELRAP----LYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHH 128
            :||.:..::..|.|:..    :||             |..|...:|.|..|||||..||:..|||
Zfish   106 VPKGNATKEFIESLQLKPGQVVYK-------------CPKCCSIKPDRAHHCSVCKRCIKKMDHH 157

  Fly   129 CPWVNNCIGRRNYRFFFFF---LVSLSIHMLSIFSLCLVYVLK----IMPNIKDTAPIVAIILMG 186
            |||||||:|..|.::|..|   :..:|:|.|.:.:...|:..:    ...:....|.::.:||:.
Zfish   158 CPWVNNCVGENNQKYFVLFTMYIALISLHALLMVAFHFVFCFEEDWAKCSSFSPPATVILLILLC 222

  Fly   187 ----LVTILAIPIFGLTGFHMV 204
                |..|....:|| |..|.:
Zfish   223 FEALLFLIFTAVMFG-TQVHSI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 38/122 (31%)
zdhhc3bNP_001071225.1 zf-DHHC 130..256 CDD:279823 38/115 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.