DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and Zdhhc4

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_082655.1 Gene:Zdhhc4 / 72881 MGIID:1920131 Length:343 Species:Mus musculus


Alignment Length:260 Identity:70/260 - (26%)
Similarity:117/260 - (45%) Gaps:56/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TRYIPATFAWIVLLLTTFLFFFYPCQF--YVKSHPWVLAYQGVITFFVLAN-----FTLATFMDP 65
            ||:  .||..:.|||...::..|.|:.  |.:...:.|.|  ::..:||.:     |||....:|
Mouse    63 TRH--PTFIVLHLLLQGLVYAEYTCEVFGYCRELEFSLPY--LLLPYVLLSVNLVFFTLTCAANP 123

  Fly    66 GIIPKASPDEDCEEELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCP 130
            |.|.||:      |.....:||..::  :..|...|.||...:|.|..||.:|:.|:..|||||.
Mouse   124 GTITKAN------ESFLLQVYKFDDV--MFPKNSRCPTCDLRKPARSKHCRLCDRCVHRFDHHCV 180

  Fly   131 WVNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYVLKIMP----------------NIKDTAPI 179
            |||||||..|.|:|..:|::|:....:|.::...::|:::.                ...||..:
Mouse   181 WVNNCIGAWNTRYFLIYLLTLTASAATIATVTAAFLLRLVTVSDLYQETYLDDVGHFQAVDTVFL 245

  Fly   180 V---------AIILMGLVTILAIPIFGLTGFHMVLVSRGRTTNEQVTGKFKGGYNPFSRGCWHNC 235
            :         .:.|:|.|.:|::.:.|...|.:.|.:..:||||            :.:|.|..|
Mouse   246 IQHLFLAFPRIVFLLGFVIVLSMLLAGYLCFALYLAATNQTTNE------------WYKGDWAWC 298

  Fly   236  235
            Mouse   299  298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 42/149 (28%)
Zdhhc4NP_082655.1 DHHC 151..292 CDD:396215 41/152 (27%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 340..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R405
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.