DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and Zdhhc24

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_081752.2 Gene:Zdhhc24 / 70605 MGIID:1917855 Length:284 Species:Mus musculus


Alignment Length:235 Identity:60/235 - (25%)
Similarity:89/235 - (37%) Gaps:56/235 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 AYQGVITFFVLANFTLATFMDPGIIPKASPDEDCEEELRAPLYKNAEINGITVKMKW--CVTCKF 106
            |||   ...:|.|..|....||.|                   :...:.|..:...|  |..|:.
Mouse    59 AYQ---LLNLLGNVVLFLRSDPSI-------------------RGVMLAGRGLGQGWAYCYQCQS 101

  Fly   107 YRPPRCSHCSVCNHCIETFDHHCPWVNNCIGRRNYRFFFFFLV---SLSIH-----------MLS 157
            ..|||..|||.|..||...||||..:..|:|..|||.|...|:   .:.:|           :|.
Mouse   102 QVPPRSGHCSACRVCILRRDHHCRLLGCCVGFHNYRPFLCLLLHSAGVLLHISVLLGPALSALLQ 166

  Fly   158 IFSLCLVYVLKIMPNIKDTAPIVAIILMGLVTILAIPIFG--LTG----FHMVLVSRGRTTNEQV 216
            ..|......|.::|.:......|::....|..::...:.|  |.|    ||.:|:.||:||.|  
Mouse   167 AHSALYTVALLLLPWLMLLTGKVSLAQFALAFVVDTCVAGALLCGAGLLFHGMLLLRGQTTWE-- 229

  Fly   217 TGKFKGGYNPFSRGCWHNCCYTQFGPQ------YPSLLNP 250
               :..|::.:..|..|| .....||:      :|.|.:|
Mouse   230 ---WARGHHCYDLGTCHN-LQAALGPRWALVWFWPFLASP 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 41/146 (28%)
Zdhhc24NP_081752.2 zf-DHHC 95..232 CDD:279823 40/141 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.