DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and Zdhhc6

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001028745.1 Gene:Zdhhc6 / 66980 MGIID:1914230 Length:413 Species:Mus musculus


Alignment Length:187 Identity:51/187 - (27%)
Similarity:79/187 - (42%) Gaps:53/187 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GVITFFVLANFTL--------ATFMDPGIIPKASPDEDCEEELRAPLYKNAEINGITVKMKWCVT 103
            |.:.|.:|.|:|:        |.|..||.:|:....|..::               ::.:::|..
Mouse    54 GSVNFIMLINWTVMILYNYFNAMFAGPGFVPRGWKPEKSQD---------------SMYLQYCKV 103

  Fly   104 CKFYRPPRCSHCSVCNHCIETFDHHCPWVNNCIGRRNYRFFFFFLVSLSI---HMLSIFSLCL-- 163
            |:.|:.||..||..||.|:...||||||:|||.|.:|:..|..||:...:   |...||.:.:  
Mouse   104 CQAYKAPRSHHCRKCNRCVMKMDHHCPWINNCCGHQNHASFTLFLLLAPLGCTHAAFIFVMTMYT 168

  Fly   164 -VY--------VLKIMPNI--KDTAPIVAIILMGLVTILAIPIFGLTGFHMVLVSRG 209
             :|        .:||..:.  :|..|||.              |||..|...|.:.|
Mouse   169 QLYNRLSFGWNTVKIDMSAARRDPPPIVP--------------FGLAAFAATLFALG 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 40/132 (30%)
Zdhhc6NP_001028745.1 DHHC 95..241 CDD:366691 40/131 (31%)
SH3_2 317..396 CDD:369452
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9H6R6 410..413
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.