DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and CG18810

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster


Alignment Length:261 Identity:76/261 - (29%)
Similarity:100/261 - (38%) Gaps:74/261 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 WIVLLLTTFLFFF----YPCQFYV--------KSHPWVLAY-----QGVITFF-VLANFTLATFM 63
            |....|..|||.|    .|..:||        .|..|...|     .|:..|. |::|:.:...:
  Fly    10 WPKEKLEQFLFLFILCGLPAIYYVLMEIILPELSDYWSPGYVFQLLLGLFLFSNVMSNYVMCILV 74

  Fly    64 DPGIIPKASPDEDCEEELRAPLYKNAEINGITVKMKW--CVTCKFYRPPRCSHCSVCNHCIETFD 126
            ||.|.||              |.||..:.| .....|  |..|....|||..||..|..|:...|
  Fly    75 DPSIDPK--------------LMKNQLVRG-QHSEDWHECDKCGILAPPRSRHCRKCGVCVLMRD 124

  Fly   127 HHCPWVNNCIGRRNYRFFFFFLV------SLSIHMLSIFSLCLVYVLK------IMPNIKDTAP- 178
            |||.:...|||..|||:||:||:      .:|:...|||    :|||.      .|  :...|| 
  Fly   125 HHCFFTGCCIGHENYRYFFYFLIYFFLSCMISLTSSSIF----IYVLHGGRYQLFM--LTHPAPN 183

  Fly   179 -------IVAIILMGLVTILAIPIFGLTGFHMVLVSRGRTTNEQVTGKFKGGYNPFSRGCWHNCC 236
                   |:.||...|..|..: :|.|.   .||:..|......|      .|:.:|||.:   |
  Fly   184 SAYFNSLIIRIIYFKLPDIYEL-VFTLV---FVLLWIGVCVATYV------AYDQWSRGYF---C 235

  Fly   237 Y 237
            |
  Fly   236 Y 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 45/146 (31%)
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 17/45 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.