DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and zdhhc4

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_956343.2 Gene:zdhhc4 / 561817 ZFINID:ZDB-GENE-030131-9031 Length:345 Species:Danio rerio


Alignment Length:281 Identity:75/281 - (26%)
Similarity:115/281 - (40%) Gaps:89/281 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FAWIVLLLTTFLF--FFYP---------------CQFYVKSHPWVLAYQGVITFFVLANFTLATF 62
            |.::.|||...::  |.|.               |..|:     :||.:..:       |.|...
Zfish    70 FLYLHLLLEVVVYGEFTYEVFGFCLDMGSSSLSLCVPYI-----LLALKSCL-------FYLCCS 122

  Fly    63 MDPGIIPKASPDEDCEEELRAPLYKNAEINGITVK-----MKWCVTCKFYRPPRCSHCSVCNHCI 122
            .|||.:.|::            |..:.:|.....|     || |.||:..:|.|..||.|||.|:
Zfish   123 RDPGTLTKSN------------LSAHLKIYQYDEKLFQQGMK-CSTCQLIKPARSKHCRVCNRCV 174

  Fly   123 ETFDHHCPWVNNCIGRRNYRFFFFFLVS----------LSIHML--SIFSLCLVYV--------- 166
            :.|||||.|||||||.:|.|:|..:|:|          |:..||  ::....|::.         
Zfish   175 QRFDHHCVWVNNCIGAQNTRYFMLYLLSVCAMAGNIAVLTTDMLLQTVLRTGLLHAHYIDEQGIQ 239

  Fly   167 -----LKIMPNIKDTAPIVAIILMGLVTILAIPIFGLTGFHMVLVSRGRTTNEQVTGK------- 219
                 |.|:.::..|.|.: :.::|.:..:...:.|...||..||...:|:||....|       
Zfish   240 QPAGPLFIIQHLFLTFPRI-VFMLGFLVFVFFLLAGYCLFHFYLVLVNQTSNEWFKAKGHNCQHC 303

  Fly   220 --FKG-----GYNPFSRGCWH 233
              :.|     .|||| ||.:|
Zfish   304 HPYSGHNCRTSYNPF-RGFYH 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 48/155 (31%)
zdhhc4NP_956343.2 DHHC 152..296 CDD:396215 46/145 (32%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 342..345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R405
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.