DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and ZDHHC4

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001358221.1 Gene:ZDHHC4 / 55146 HGNCID:18471 Length:359 Species:Homo sapiens


Alignment Length:320 Identity:87/320 - (27%)
Similarity:133/320 - (41%) Gaps:84/320 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TFAWIVLLLT-------TFLFFFYPCQFYVKSHPWVLAY--QGVITFFVLANFTLATFMDPGIIP 69
            ||..:.|:|.       |:..|.|..:..:..|..:|.|  .||..||    |||....:||||.
Human    67 TFIVLHLVLQGMVYTEYTWEVFGYCQELELSLHYLLLPYLLLGVNLFF----FTLTCGTNPGIIT 127

  Fly    70 KASPDEDCEEELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCS---------------VCN 119
            ||:      |.|...:|:..|:  :..|...|.||...:|.|..|||               |||
Human   128 KAN------ELLFLHVYEFDEV--MFPKNVRCSTCDLRKPARSKHCSECGSRDSSGTSNSTCVCN 184

  Fly   120 HCIETFDHHCPWVNNCIGRRNYRFFFFFLVSL--SIHMLSIFSLCLVYVLKIMP----------- 171
            .|:..|||||.|||||||..|.|:|..::::|  |...::|.|...:..|.:|.           
Human   185 WCVHRFDHHCVWVNNCIGAWNIRYFLIYVLTLTASAATVAIVSTTFLVHLVVMSDLYQETYIDDL 249

  Fly   172 ---NIKDTAPIV---------AIILMGLVTILAIPIFGLTGFHMVLVSRGRTTNEQVTGKFKGGY 224
               ::.||..::         .:.::|.|.:|:..:.|...|.:.|.:..:||||          
Human   250 GHLHVMDTVFLIQYLFLTFPRIVFMLGFVVVLSFLLGGYLLFVLYLAATNQTTNE---------- 304

  Fly   225 NPFSRGCWHNCCYTQFGP--QYPSLLNPKKYAS-----RRSQVQNQAISTI-CNDRSGQQ 276
              :.||.|..|   |..|  .:|....|:.:.:     .||.:|...:... |::|..|:
Human   305 --WYRGDWAWC---QRCPLVAWPPSAEPQVHRNIHSHGLRSNLQEIFLPAFPCHERKKQE 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 46/164 (28%)
ZDHHC4NP_001358221.1 DHHC 151..307 CDD:366691 45/167 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R405
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.