DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and ZDHHC9

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001008223.1 Gene:ZDHHC9 / 51114 HGNCID:18475 Length:364 Species:Homo sapiens


Alignment Length:281 Identity:108/281 - (38%)
Similarity:161/281 - (57%) Gaps:33/281 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VLLLTTFLFFFYPCQFY-VKSHPWVLAYQGVITFFVLANFTLATFMDPGIIPKASPDEDC--EEE 80
            ::|.|..|||.:.|::. |:..|.:..:..::..|.:|.....:|.|||:||:|.|||..  |.|
Human    44 LILGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEME 108

  Fly    81 LRA------------PLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPWVN 133
            :.|            |..||.:||...||:|:|.|||.:||||.||||:|::|:|.||||||||.
Human   109 IEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVG 173

  Fly   134 NCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYV----LKI--MPNIKDTAPIVAIILMGLVTILA 192
            ||:|:||||:|:.|::|||:..:.:|:..:|||    |||  :..:|:|...|..:|:...|:.:
Human   174 NCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKETPGTVLEVLICFFTLWS 238

  Fly   193 IPIFGLTGFHMVLVSRGRTTNEQVTGKFKGG---YNPFSRG-CWHNCCYTQFGPQYPSLLNPK-- 251
              :.||||||..||:..:||||.:.|.:.|.   .||:|.| ...|||....||..||:|:.:  
Human   239 --VVGLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRGI 301

  Fly   252 ----KYASRRSQVQNQAISTI 268
                :..||....|..:.|.:
Human   302 LPLEESGSRPPSTQETSSSLL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 62/130 (48%)
ZDHHC9NP_001008223.1 DHHC 138..261 CDD:396215 60/124 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..364 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264614at2759
OrthoFinder 1 1.000 - - FOG0000285
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R405
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.