DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and CG5880

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster


Alignment Length:262 Identity:62/262 - (23%)
Similarity:96/262 - (36%) Gaps:94/262 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YIPATFAWIVLLLTTFLFFFYPCQFYVKSHPWVLAYQGVITFFVLANFTLATFMDPGIIPKASPD 74
            :|...|.|....|.|:        |.:....|:|.  .|:..:|:|..|          |...|.
  Fly    83 WIGLPFWWAKSQLVTY--------FLLIVGNWLLL--NVVFHYVMAVIT----------PAGHPP 127

  Fly    75 EDCEEELRAPLYKNAEINGITV--KMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPWVNNCIG 137
            |                 |:::  .:..|..|...:|||..|||:||.||...||||||:|||:|
  Fly   128 E-----------------GVSLVEAVSMCGKCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVG 175

  Fly   138 RRNYRFFFFFL--VSLSIHMLSIFSLCL-----------------------------VYVLKIM- 170
            ..|:|:||.::  .:|....|.:|.|.:                             .:::.:. 
  Fly   176 YGNHRYFFLYMTYTTLGCLFLILFGLEIGHKYLWLDHGENWTEIEPLEGQPVKFNLSGHIIPVTH 240

  Fly   171 PNIKD-----------TAPIV-----------AIILMGLVTILAIPIFG-LTGFHMVLVSRGRTT 212
            ||..|           ..|||           |:..|....:..:...| |:.:|..|::||.|:
  Fly   241 PNEYDEFVLPPAVHNLPTPIVDTDAASPGRRRALWFMAFTNVAVVLALGSLSIWHAKLITRGETS 305

  Fly   213 NE 214
            .|
  Fly   306 VE 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 46/178 (26%)
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 29/61 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.