DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and CG4956

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster


Alignment Length:238 Identity:60/238 - (25%)
Similarity:94/238 - (39%) Gaps:45/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FAWIVLLLTTFLFFFYPCQFYVKS--------HP--WVLAYQGVITFFVLANFTLATFMDPGIIP 69
            |..|.||....|.|.|...:.:..        |.  |.:....||.  :|.|:.|      |.:.
  Fly    44 FCAIFLLCLIGLLFVYELCYVLPQITDPHGIWHKLCWFMGIYTVIN--ILGNWWL------GCMT 100

  Fly    70 KASPDEDCEEELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPWVNN 134
            ..|.|.       ..|.:...:.|......:|.||:...|||..|||:||.||...||||.:..:
  Fly   101 NTSVDS-------LVLERQYPVAGEAHLWHYCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFAS 158

  Fly   135 CIGRRNYRFFFFFLVSLSI---------HMLSIFSLCLVYVLKIMPNIKDTA---------PIVA 181
            |||.:|.|:|..||..||.         .:|:..:...:.|..::...:||.         .|..
  Fly   159 CIGHKNQRYFLAFLFHLSFGSGQALVYNGILNWTNKAFLVVDPLLLMFQDTTQDADFKWKYTIAN 223

  Fly   182 IILMGLVTILAIPIFGLTGFHMVLVSRGRTTNEQVTGKFKGGY 224
            :..:.|. :..:|:| :..|.|::|.|..|..:.:...:..|:
  Fly   224 LFKLNLF-LFGVPLF-MFVFQMIMVYRNSTCYKMLDRSYDVGW 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 40/142 (28%)
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 39/129 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.