DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and CG17195

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster


Alignment Length:247 Identity:64/247 - (25%)
Similarity:100/247 - (40%) Gaps:60/247 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IVLLLTTFLFFFYPCQFYVKSHP---------WVLAYQGVITFFVLANFTLATFMDPGIIPKASP 73
            ||.:|.:..|||....||:....         |:|.  ..||..:|.|. ||.:|....:...|.
  Fly    28 IVFVLCSTAFFFSLQMFYIAPKVFGDIAYKLYWILV--TFITHNILGNM-LACYMTSSSVNTLSK 89

  Fly    74 DEDCEEELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPWVNNCIGR 138
            |..|......||:            .:|.:||..|.||..||.:||.||...||||.:...|||.
  Fly    90 DSRCPNPEDEPLW------------HYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGH 142

  Fly   139 RNYRFFFFFLVSLSIHMLSIFSLCLVYVLKIMPNIKDTAPIVAIILMG----------------L 187
            .|.||||:|...|::.:::.|:...:::|:...|....:.::..::..                |
  Fly   143 NNQRFFFWFTFYLTLGLVTSFATFCMFILQNGGNFMSLSSVIFNLITRTFFQNYTGNTFETIAFL 207

  Fly   188 VTILA--IPIFGLTGFHMVLVSRGRTTNEQVTGKFKGGYNPFSRGCWHNCCY 237
            :.|.|  :|.| :..:.|.::|:..|.           ||.|      :|.|
  Fly   208 LNISASYMPAF-MLAYQMQILSQNSTY-----------YNIF------DCTY 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 37/142 (26%)
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 37/142 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.