DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and CG17196

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_651426.1 Gene:CG17196 / 43112 FlyBaseID:FBgn0039368 Length:276 Species:Drosophila melanogaster


Alignment Length:268 Identity:66/268 - (24%)
Similarity:106/268 - (39%) Gaps:68/268 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IVLLLTTFLFFFYPCQFYVKSHPWVLAYQG-VITFFVL-ANFT--------LATFMDPGIIPKAS 72
            ::.||.:.:|||....|||...    .:.| :..|||: |.||        ||.:.....: |:.
  Fly    28 VIFLLVSTVFFFTLQVFYVAPD----VHDGFMYKFFVISAIFTTYNILGNLLACYRTSSAV-KSL 87

  Fly    73 PDEDCEEELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPWVNNCIG 137
            |.   |.::..|        |......:|..|:...|||..||::|..||...||||.:...|||
  Fly    88 PQ---ERQIPKP--------GTEHLWHYCDICQKLMPPRSWHCALCKCCILKRDHHCIFAATCIG 141

  Fly   138 RRNYRFFF---FFLV-SLSIHMLSIF-----SLCLVY--------VLKIMPNIKDTAPIVAIILM 185
            ..|:|:||   |:|. .:.:.|.::|     |..|::        .:|.:...:....|:.|..:
  Fly   142 HNNHRYFFWLTFYLAFGIFMSMATLFVDVGRSFYLLHRMKAGFGNTVKSLSYFRYVCLILNIFAL 206

  Fly   186 GLVTIL---AIPIFGLTGFHMVLVSRG-----RTTNEQVTGKFKGGYNPFSRGCWHNCCYTQFGP 242
            |...::   .:.|..|...:..:.||.     |...:.:.|:         ||.|....      
  Fly   207 GFPALMLRFQVQILKLNSTYYQISSRHHDLGFRNNCQLIMGQ---------RGLWTFIS------ 256

  Fly   243 QYPSLLNP 250
              |||.:|
  Fly   257 --PSLRSP 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 36/149 (24%)
CG17196NP_651426.1 zf-DHHC 103..228 CDD:279823 33/124 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.