DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and CG5196

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster


Alignment Length:234 Identity:60/234 - (25%)
Similarity:105/234 - (44%) Gaps:57/234 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PATFAWIV--LLLTTFLFFFYPCQFYVKSHPWV-------LAYQGVITFFVLA-----NFTLATF 62
            |.|...|:  :.|||         .|:.|..|.       .|:|.:  |.:|:     |:.:||.
  Fly    16 PITALSIIKCITLTT---------LYMNSMWWPPNKSFAGFAHQAL--FLLLSTLATFNYVMATL 69

  Fly    63 MDPGIIPKASPDEDCEEELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDH 127
            ..||::||....:|       |  |:|:.      :::|..|:.|:.||..||..|:.|::..||
  Fly    70 TGPGLMPKQWHPKD-------P--KDAQF------LQYCKKCEGYKAPRSHHCRKCDRCVKKMDH 119

  Fly   128 HCPWVNNCIGRRNYRFF-FFFLVSLSIHMLSIFSLC------------LVYVLKIMPNIKDTAPI 179
            ||||:|:|:|..|:.:| :|.|.|:...:.....||            |.:.|..:.:::.|...
  Fly   120 HCPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCCSFWRGIYRYYYLTHGLAHLASVQFTLLS 184

  Fly   180 VAIILMGLVTILAIPIFGLTGFHMVLVSRGRTTNEQVTG 218
            :.:.::|:...:.:.|    |..|:|..:.:|.....||
  Fly   185 IIMCILGMGLAIGVVI----GLSMLLFIQLKTIVNNQTG 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 36/138 (26%)
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 36/141 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.