DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and CG13029

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster


Alignment Length:317 Identity:83/317 - (26%)
Similarity:117/317 - (36%) Gaps:96/317 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RYI----PATFAWIV-------LLLTTFLFFFYPCQFYVKSH-----------PWVLAYQGVITF 51
            :||    |..||.||       :|:.|.|||... .||:...           .|::|.  .|.:
  Fly     9 KYIANANPKRFAKIVHPSAVGFVLVGTVLFFSVE-MFYMLPRIYDTDGLFFKIAWLMAL--FIVY 70

  Fly    52 FVLANFTLATFMDPGIIPKASPDED--CEEELRAPLYKNAEINGITVKMKW--CVTCKFYRPPRC 112
            .:|.|. ||...:...:.....|..  |.||                |..|  |..|:...|||.
  Fly    71 NLLGNM-LACHRNSSAVTSLPKDRQIPCPEE----------------KHLWHFCDHCQMLVPPRS 118

  Fly   113 SHCSVCNHCIETFDHHCPWVNNCIGRRNYRFFFFF--------LVSLSIHM-------------- 155
            .||.||..||...||||.:...|:|..|||:||:|        |:||:.|:              
  Fly   119 WHCKVCECCILRRDHHCIFTATCVGHTNYRYFFWFTVYMHIGSLLSLATHVNLLIIDEQIRRQYV 183

  Fly   156 ---LSIFSL------CLVYVLKIMPNIKDTAPIVAIILMGLVTILAIPIFGL-TGFHMVLVSRGR 210
               .|.|.|      |.:..|.|...|...|.|:::|::|    ..||...| |.|:   ..:..
  Fly   184 VLHFSRFFLFLKPMSCELIALNISFIINIYACILSLIMLG----YQIPALYLNTTFY---TPKDY 241

  Fly   211 TTNEQVTGKFKGGYNPFSRGCWHNCCYTQFGPQYPSLLNPKKYASRRSQVQNQAIST 267
            ..|:.:.|.|.....  .||.|....        ||:.:|..:...:.|.: ||.:|
  Fly   242 RYNQGLLGNFMAFMG--KRGLWTFIS--------PSIRSPLPHDGTKWQTK-QAPTT 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 46/158 (29%)
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 45/155 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.