Sequence 1: | NP_001259382.1 | Gene: | Zdhhc8 / 31887 | FlyBaseID: | FBgn0085478 | Length: | 1052 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009304660.1 | Gene: | zdhhc16b / 393316 | ZFINID: | ZDB-GENE-040426-1301 | Length: | 382 | Species: | Danio rerio |
Alignment Length: | 295 | Identity: | 74/295 - (25%) |
---|---|---|---|
Similarity: | 112/295 - (37%) | Gaps: | 92/295 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 DVKTRYIPATFAWIVLLLTT------------FLFFFYPCQFYVKSHPWVLAYQGVITFFVLANF 57
Fly 58 TLATFMDPGIIPKASPDEDCEEELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCI 122
Fly 123 ETFDHHCPWVNNCIGRRNYRFFFFF-------LVSLSIHMLSIF--------------------- 159
Fly 160 --SLCLVYVLKIMPNIKDTAPIV-----------AIILMGLVTILAIPIFGLTGFHMVLVSRGRT 211
Fly 212 TNE-----------QVTGK-FKGGYNPFSRGCWHN 234 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Zdhhc8 | NP_001259382.1 | zf-DHHC | 94..219 | CDD:279823 | 46/176 (26%) |
zdhhc16b | XP_009304660.1 | zf-DHHC | 83..>206 | CDD:327686 | 44/146 (30%) |
zf-DHHC | 154..310 | CDD:307600 | 44/159 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |