DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and CG17287

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster


Alignment Length:266 Identity:68/266 - (25%)
Similarity:113/266 - (42%) Gaps:56/266 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKCDVKTRYIPATFAWIVLLLTTFLFFFYPCQFYVKSHPWV---LAYQGVITFFVLANFTLATF 62
            :|.|.|  |::||......|:.:..:|.:..|...|..:..:   |.:..::.|..|..:....|
  Fly    11 VPCCAV--RWLPALIILGFLVWSYHVFVYQICIKKVSDYLTIGLLLFFYHLLLFMFLWTWFRCIF 73

  Fly    63 MDPGIIP---KASPDEDCEEELRAPLYKNAEING------------------ITVKMKWCVTCKF 106
            :.|..||   |.|| ||.::     |.:|..|.|                  |...:::|.||..
  Fly    74 VAPVRIPDQWKISP-EDVDK-----LKRNDGIEGASRVLNYAARNLPIATCTIDGLVRYCKTCWI 132

  Fly   107 YRPPRCSHCSVCNHCIETFDHHCPWVNNCIGRRNYRFFFFFLVSLSIHMLSIFSLCLVYVLKIMP 171
            .:|.|..||..|:.|:...||||||:.||:...|:::|..||....::...:|.: :||.|.::.
  Fly   133 IKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCV-MVYDLYLIC 196

  Fly   172 NIKDTA----------PIVAIILMGLVTILAIPIFGLTGFHMVLVSRGRTTNEQ-------VTGK 219
            ..:.||          ..:..||..:.|::...:      .::.|||.|||.|.       :.||
  Fly   197 GFEVTALKNQHSWNILQYLVCILFNIFTVIMYTV------SLLNVSRNRTTMESAYATYFLLGGK 255

  Fly   220 FKGGYN 225
            ...|:|
  Fly   256 NNNGFN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 38/141 (27%)
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 36/124 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.