DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zdhhc8 and Zdhhc17

DIOPT Version :9

Sequence 1:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster
Sequence 2:NP_001034429.1 Gene:Zdhhc17 / 366889 RGDID:1595790 Length:622 Species:Rattus norvegicus


Alignment Length:271 Identity:74/271 - (27%)
Similarity:112/271 - (41%) Gaps:79/271 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ATFAWIVLLLTTFLFFFYPCQFYVKSHPWVLAYQGVITFFVLANFTLATFMDPGIIPKASPDEDC 77
            ||..|   :..|:.|:|:....::..|...|| ..|..|:   ||..:...||||| ||:     
  Rat   355 ATKFW---MYVTWFFWFWNDLSFLSIHLPFLA-NSVALFY---NFGKSWKSDPGII-KAT----- 406

  Fly    78 EEELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPWVNNCIGRRNYR 142
            ||:.:..:.:.||...:.:.: :|.||...:|.|..||.|||.||..||||||||.||:...|:|
  Rat   407 EEQKKKTIVELAETGSLDLSI-FCSTCLIRKPVRSKHCGVCNRCIAKFDHHCPWVGNCVCAGNHR 470

  Fly   143 FFFFFLVSLSIHMLSIFSLC-LVY------------------VLKIMPNIKDTAPIVAIILMGLV 188
            :|..:|..|      :|.:| ::|                  ....:..|...:|.:..:.:..|
  Rat   471 YFMGYLFFL------LFMICWMIYGCVSYWGLHCETTYTKDGFWTYITQIATCSPWMFWMFLNSV 529

  Fly   189 TILAIPIFGLTGFHMVLVS------------RGRTTNEQVTGK----FK----GGYNPFSRGCWH 233
                        ||.:.|:            .|.||||::..:    ||    ...:||:.||..
  Rat   530 ------------FHFMWVAVLLMCQMYQITCLGITTNERMNARRYKHFKVTTTSIESPFNHGCVR 582

  Fly   234 N--------CC 236
            |        ||
  Rat   583 NIIDFFEFRCC 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 41/155 (26%)
Zdhhc17NP_001034429.1 Necessary and sufficient for interaction with DNAJC5 and SNAP25. /evidence=ECO:0000250|UniProtKB:Q80TN5 1..295
Ank_4 <60..100 CDD:290365
ANK 77..192 CDD:238125
ANK repeat 79..110 CDD:293786
Ank_2 84..177 CDD:289560
ANK repeat 112..144 CDD:293786
ANK 143..267 CDD:238125
ANK repeat 146..177 CDD:293786
Ank_2 151..245 CDD:289560
ANK repeat 179..211 CDD:293786
ANK repeat 214..245 CDD:293786
zf-DHHC 428..558 CDD:279823 41/147 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.